Calicin Antikörper (C-Term)

Produktnummer ABIN631496

Der Kaninchen-Polyklonal Anti-Calicin-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von Calicin in Proben aus Human, Maus und Ratte. }

Kurzübersicht für Calicin Antikörper (C-Term) (ABIN631496)

Target: Calicin (CCIN)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Calicin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Calicin Antikörper

Bindungsspezifität: C-Term

Spezifität: Calicin antibody was raised against the C terminal of CCIN

Aufreinigung: Affinity purified

Immunogen: Calicin antibody was raised using the C terminal of CCIN corresponding to a region with amino acids TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Calicin Blocking Peptide, (ABIN5612579), is also available for use as a blocking control in assays to test for specificity of this Calicin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCIN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Calicin

Target: Calicin (CCIN)

Andere Bezeichnung: Calicin

Hintergrund: CCIN is a basic protein of the sperm head cytoskeleton. This protein contains kelch repeats and a BTB/POZ domain and is necessary for normal morphology during sperm differentiation.

Molekulargewicht: 65 kDa (MW of target protein)