PCYT2 Antikörper (Middle Region)

Produktnummer ABIN631492

Produktdetails anti-PCYT2 Antikörper

Target: PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCYT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCYT2 antibody was raised against the middle region of PCYT2

Aufreinigung: Affinity purified

Immunogen: PCYT2 antibody was raised using the middle region of PCYT2 corresponding to a region with amino acids KCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCYT2 Blocking Peptide, catalog no. 33R-4274, is also available for use as a blocking control in assays to test for specificity of this PCYT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCYT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCYT2

Target: PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))

Andere Bezeichnung: PCYT2 (PCYT2 Produkte)

Synonyme: ET antikoerper, 1110033E03Rik antikoerper, ethanolamine-phosphate cytidylyltransferase antikoerper, putative ethanolamine-phosphate cytidylyltransferase antikoerper, Ethanolamine-phosphate cytidylyltransferase antikoerper, phosphate cytidylyltransferase 2, ethanolamine antikoerper, phosphate cytidylyltransferase 2, ethanolamine L homeolog antikoerper, Tc00.1047053511727.120 antikoerper, Tb11.01.5730 antikoerper, LINJ_32_0940 antikoerper, LOC5566800 antikoerper, LMJF_32_0890 antikoerper, EDI_013070 antikoerper, EDI_204270 antikoerper, CpipJ_CPIJ009320 antikoerper, Bm1_01855 antikoerper, pcy2 antikoerper, PCYT2 antikoerper, Pcyt2 antikoerper, pcyt2.L antikoerper

Hintergrund: PCYT2 is an enzyme that catalyzes the formation of CDP-ethanolamine from CTP and phosphoethanolamine in the Kennedy pathway of phospholipid synthesis. Alternative splicing results in multiple transcript variants.

Molekulargewicht: 44 kDa (MW of target protein)