PCYT2 Antikörper (Middle Region)

Produktnummer ABIN631492

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PCYT2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für PCYT2 Antikörper (Middle Region) (ABIN631492)

Target: PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCYT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PCYT2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PCYT2 antibody was raised against the middle region of PCYT2

Aufreinigung: Affinity purified

Immunogen: PCYT2 antibody was raised using the middle region of PCYT2 corresponding to a region with amino acids KCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCYT2 Blocking Peptide, (ABIN939660), is also available for use as a blocking control in assays to test for specificity of this PCYT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCYT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCYT2

Target: PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))

Andere Bezeichnung: PCYT2

Hintergrund: PCYT2 is an enzyme that catalyzes the formation of CDP-ethanolamine from CTP and phosphoethanolamine in the Kennedy pathway of phospholipid synthesis. Alternative splicing results in multiple transcript variants.

Molekulargewicht: 44 kDa (MW of target protein)