Calretinin Antikörper (N-Term)

Produktnummer ABIN631478

Produktdetails anti-Calretinin Antikörper

Target: Calretinin (CALB2) (Calbindin 2 (CALB2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Calretinin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Calbindin 2 antibody was raised against the N terminal of CALB2

Aufreinigung: Affinity purified

Immunogen: Calbindin 2 antibody was raised using the N terminal of CALB2 corresponding to a region with amino acids IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Calbindin 2 Blocking Peptide, catalog no. 33R-3997, is also available for use as a blocking control in assays to test for specificity of this Calbindin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Calretinin

Target: Calretinin (CALB2) (Calbindin 2 (CALB2))

Andere Bezeichnung: Calbindin 2 (CALB2 Produkte)

Hintergrund: CALB2 is an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. Three alternatively spliced transcript variants that encode different proteins have been described.

Molekulargewicht: 30 kDa (MW of target protein)