LAP3 Antikörper (N-Term)

Produktnummer ABIN631475

Der Kaninchen Polyklonal Anti-LAP3-Antikörper wurde für WB validiert. Er ist geeignet, LAP3 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für LAP3 Antikörper (N-Term) (ABIN631475)

Target: LAP3 (Cytosol Aminopeptidase (LAP3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LAP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LAP3 Antikörper

Bindungsspezifität: N-Term

Spezifität: LAP3 antibody was raised against the N terminal of LAP3

Aufreinigung: Affinity purified

Immunogen: LAP3 antibody was raised using the N terminal of LAP3 corresponding to a region with amino acids LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LAP3 Blocking Peptide, (ABIN5614413), is also available for use as a blocking control in assays to test for specificity of this LAP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LAP3

Target: LAP3 (Cytosol Aminopeptidase (LAP3))

Andere Bezeichnung: LAP3

Hintergrund: LAP3 is presumably involved in the processing and regular turnover of intracellular proteins. LAP3 catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.

Molekulargewicht: 56 kDa (MW of target protein)