CDC42EP4 Antikörper

Produktnummer ABIN631473

Produktdetails anti-CDC42EP4 Antikörper

Target: CDC42EP4 (CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDC42EP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CDC42 EP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDC42EP4 Blocking Peptide, catalog no. 33R-8850, is also available for use as a blocking control in assays to test for specificity of this CDC42EP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC40 P4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDC42EP4

Target: CDC42EP4 (CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4))

Andere Bezeichnung: CDC42EP4 (CDC42EP4 Produkte)

Hintergrund: CDC42EP4 is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. The protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, the protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.

Molekulargewicht: 38 kDa (MW of target protein)