METAP2 Antikörper (N-Term)

Produktnummer ABIN631470

Dieses Anti-METAP2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von METAP2 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für METAP2 Antikörper (N-Term) (ABIN631470)

Target: METAP2 (Methionyl Aminopeptidase 2 (METAP2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser METAP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-METAP2 Antikörper

Bindungsspezifität: N-Term

Spezifität: METAP2 antibody was raised against the N terminal of METAP2

Aufreinigung: Affinity purified

Immunogen: METAP2 antibody was raised using the N terminal of METAP2 corresponding to a region with amino acids ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

METAP2 Blocking Peptide, (ABIN936942), is also available for use as a blocking control in assays to test for specificity of this METAP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METAP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu METAP2

Target: METAP2 (Methionyl Aminopeptidase 2 (METAP2))

Andere Bezeichnung: METAP2

Hintergrund: METAP2 is a member of the methionyl aminopeptidase family and encodes a protein that binds 2 cobalt or manganese ions. This protein functions both by protecting the alpha subunit of eukaryotic initiation factor 2 from inhibitory phosphorylation and by removing the amino-terminal methionine residue from nascent protein. Increased expression of this gene is associated with various forms of cancer and the anti-cancer drugs fumagillin and ovalicin inhibit the protein by irreversibly binding to its active site.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling