TKTL2 Antikörper (N-Term)
-
- Target Alle TKTL2 Antikörper anzeigen
- TKTL2 (Transketolase-Like 2 (TKTL2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TKTL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TKTL2 antibody was raised against the N terminal of TKTL2
- Aufreinigung
- Affinity purified
- Immunogen
- TKTL2 antibody was raised using the N terminal of TKTL2 corresponding to a region with amino acids QLTSCCSAAEVVSVLFFHTMKYKQTDPEHPDNDRFILSRGHAAPILYAAW
- Top Product
- Discover our top product TKTL2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TKTL2 Blocking Peptide, catalog no. 33R-7651, is also available for use as a blocking control in assays to test for specificity of this TKTL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TKTL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TKTL2 (Transketolase-Like 2 (TKTL2))
- Andere Bezeichnung
- TKTL2 (TKTL2 Produkte)
- Synonyme
- TKTL2 antikoerper, 4933401I19Rik antikoerper, RGD1304767 antikoerper, transketolase like 2 antikoerper, transketolase-like 2 L homeolog antikoerper, transketolase-like 2 antikoerper, TKTL2 antikoerper, tktl2.L antikoerper, Tktl2 antikoerper
- Hintergrund
- The function of TCP10 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 68 kDa (MW of target protein)
-