MYH10 Antikörper (N-Term)

Produktnummer ABIN631458

Dieses Anti-MYH10-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von MYH10 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für MYH10 Antikörper (N-Term) (ABIN631458)

Target: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MYH10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MYH10 Antikörper

Bindungsspezifität: N-Term

Spezifität: MYH10 antibody was raised against the N terminal of MYH10

Aufreinigung: Affinity purified

Immunogen: MYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MYH10 Blocking Peptide, (ABIN5614894), is also available for use as a blocking control in assays to test for specificity of this MYH10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYH10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MYH10

Target: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Andere Bezeichnung: MYH10

Hintergrund: MYH10 is the cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping.

Molekulargewicht: 229 kDa (MW of target protein)