BLMH Antikörper (Middle Region)
-
- Target Alle BLMH Antikörper anzeigen
- BLMH (Bleomycin Hydrolase (BLMH))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BLMH Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BLMH antibody was raised against the middle region of BLMH
- Aufreinigung
- Affinity purified
- Immunogen
- BLMH antibody was raised using the middle region of BLMH corresponding to a region with amino acids EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL
- Top Product
- Discover our top product BLMH Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BLMH Blocking Peptide, catalog no. 33R-2825, is also available for use as a blocking control in assays to test for specificity of this BLMH antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLMH antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BLMH (Bleomycin Hydrolase (BLMH))
- Andere Bezeichnung
- BLMH (BLMH Produkte)
- Hintergrund
- The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.
- Molekulargewicht
- 52 kDa (MW of target protein)
-