BLMH Antikörper (Middle Region)

Produktnummer ABIN631453

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch BLMH in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte und Maus.

Kurzübersicht für BLMH Antikörper (Middle Region) (ABIN631453)

Target: BLMH (Bleomycin Hydrolase (BLMH))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BLMH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BLMH Antikörper

Bindungsspezifität: Middle Region

Spezifität: BLMH antibody was raised against the middle region of BLMH

Aufreinigung: Affinity purified

Immunogen: BLMH antibody was raised using the middle region of BLMH corresponding to a region with amino acids EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BLMH Blocking Peptide, (ABIN938211), is also available for use as a blocking control in assays to test for specificity of this BLMH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLMH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BLMH

Target: BLMH (Bleomycin Hydrolase (BLMH))

Andere Bezeichnung: BLMH

Hintergrund: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.

Molekulargewicht: 52 kDa (MW of target protein)