PARP9 Antikörper

Produktnummer ABIN631447

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PARP9 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für PARP9 Antikörper (ABIN631447)

Target: PARP9 (Poly (ADP-Ribose) Polymerase Family, Member 9 (PARP9))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PARP9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PARP9 Antikörper

Aufreinigung: Affinity purified

Immunogen: PARP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PARP9 Blocking Peptide, (ABIN940399), is also available for use as a blocking control in assays to test for specificity of this PARP9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PARP9

Target: PARP9 (Poly (ADP-Ribose) Polymerase Family, Member 9 (PARP9))

Andere Bezeichnung: PARP9

Hintergrund: PARP9 contains 2 Macro domains and 1 PARP catalytic domain. PARP9 is overexpressed at significantly higher levels in fatal high-risk diffuse large B-cell lymphomas (DLB-CL) compared to cured low-risk tumors. Overexpression of PARP9 in B-cell lymphoma transfectants may promote malignant B-cell migration. The function of PARP9 remains unknown.

Molekulargewicht: 96 kDa (MW of target protein)