Glycogen Synthase 2 Antikörper

Produktnummer ABIN631445

Der Kaninchen Polyklonal anti-Glycogen Synthase 2 Antikörper wird verwendet zum Nachweis von Glycogen Synthase 2 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für Glycogen Synthase 2 Antikörper (ABIN631445)

Target: Glycogen Synthase 2 (GYS2) (Glycogen Synthase 2, Liver (GYS2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Glycogen Synthase 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Glycogen Synthase 2 Antikörper

Aufreinigung: Affinity purified

Immunogen: Glycogen Synthase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Glycogen Synthase 2 Blocking Peptide, (ABIN5613798), is also available for use as a blocking control in assays to test for specificity of this Glycogen Synthase 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GYS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Glycogen Synthase 2

Target: Glycogen Synthase 2 (GYS2) (Glycogen Synthase 2, Liver (GYS2))

Andere Bezeichnung: Glycogen Synthase 2

Hintergrund: GYS2 transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.

Molekulargewicht: 81 kDa (MW of target protein)

Pathways: AMPK Signaling, Cellular Glucan Metabolic Process