RAB1A Antikörper (Middle Region)

Produktnummer ABIN631433

Der Kaninchen Polyklonal Anti-RAB1A-Antikörper wurde für WB validiert. Er ist geeignet, RAB1A in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für RAB1A Antikörper (Middle Region) (ABIN631433)

Target: RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAB1A Antikörper

Bindungsspezifität: Middle Region

Spezifität: RAB1 A antibody was raised against the middle region of RAB1

Aufreinigung: Affinity purified

Immunogen: RAB1 A antibody was raised using the middle region of RAB1 corresponding to a region with amino acids AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB1A Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this RAB1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB1A

Target: RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))

Andere Bezeichnung: RAB1A

Hintergrund: This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom