Hsc70 Antikörper (N-Term)

Produktnummer ABIN631424

Produktdetails anti-Hsc70 Antikörper

Target: Hsc70 (HSPA8) (Heat Shock 70kDa Protein 8 (HSPA8))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus, Hund, Drosophila melanogaster, C. elegans, Arabidopsis

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Hsc70 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HSPA8 antibody was raised against the N terminal of HSPA8

Aufreinigung: Affinity purified

Immunogen: HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPA8 Blocking Peptide, catalog no. 33R-6448, is also available for use as a blocking control in assays to test for specificity of this HSPA8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Hsc70

Target: Hsc70 (HSPA8) (Heat Shock 70kDa Protein 8 (HSPA8))

Andere Bezeichnung: HSPA8 (HSPA8 Produkte)

Synonyme: hsc54 antikoerper, hsc70 antikoerper, hsc71 antikoerper, hsp71 antikoerper, hsp73 antikoerper, hspa10 antikoerper, lap1 antikoerper, nip71 antikoerper, HSC54 antikoerper, HSC70 antikoerper, HSC71 antikoerper, HSP71 antikoerper, HSP73 antikoerper, HSPA10 antikoerper, LAP1 antikoerper, NIP71 antikoerper, Hsc70 antikoerper, 2410008N15Rik antikoerper, Hsc71 antikoerper, Hsc73 antikoerper, Hsp73 antikoerper, Hspa10 antikoerper, wu:fb01g06 antikoerper, wu:fi48b06 antikoerper, heat shock protein family A (Hsp70) member 8 L homeolog antikoerper, heat shock protein family A (Hsp70) member 8 antikoerper, heat shock 70kDa protein 8 antikoerper, heat shock protein 8 antikoerper, hspa8.L antikoerper, HSPA8 antikoerper, Hspa8 antikoerper, hspa8 antikoerper

Hintergrund: HSPA8 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA8 is a heat-shock cognate protein. The protein binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Two alternatively spliced variants have been characterized to date.

Molekulargewicht: 71 kDa (MW of target protein)