Hsc70 Antikörper (N-Term)

Produktnummer ABIN631424

Der Kaninchen Polyklonal Anti-Hsc70-Antikörper wurde für WB validiert. Er ist geeignet, Hsc70 in Proben von Human, Ratte, Maus, Hund, Drosophila melanogaster, C. elegans und Arabidopsis zu detektieren.

Kurzübersicht für Hsc70 Antikörper (N-Term) (ABIN631424)

Target: Hsc70 (HSPA8) (Heat Shock 70kDa Protein 8 (HSPA8))

Reaktivität: Human, Ratte, Maus, Hund, Drosophila melanogaster, C. elegans, Arabidopsis

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Hsc70 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Hsc70 Antikörper

Bindungsspezifität: N-Term

Spezifität: HSPA8 antibody was raised against the N terminal of HSPA8

Aufreinigung: Affinity purified

Immunogen: HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPA8 Blocking Peptide, (ABIN5614100), is also available for use as a blocking control in assays to test for specificity of this HSPA8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Hsc70

Target: Hsc70 (HSPA8) (Heat Shock 70kDa Protein 8 (HSPA8))

Andere Bezeichnung: HSPA8

Hintergrund: HSPA8 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA8 is a heat-shock cognate protein. The protein binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Two alternatively spliced variants have been characterized to date.

Molekulargewicht: 71 kDa (MW of target protein)