Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 6 (HS3ST6) Antikörper

Produktnummer ABIN631415

Der Kaninchen Polyklonal Anti--Antikörper wurde für WB validiert. Er ist geeignet, in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 6 (HS3ST6) Antikörper (ABIN631415)

Target: Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 6 (HS3ST6)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Aufreinigung: Affinity purified

Immunogen: HS3 ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HS3ST6 Blocking Peptide, (ABIN938635), is also available for use as a blocking control in assays to test for specificity of this HS3ST6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 6 (HS3ST6)

Andere Bezeichnung: HS3ST6

Hintergrund: HS3ST6 is a single-pass type II membrane protein. It belongs to the sulfotransferase 1 family. It transfers a sulfuryl group to heparan sulfate. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes Simplex Virus-1 (HSV-1) and permits its entry. Unlike 3-OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process