AMOTL1 Antikörper (N-Term)

Produktnummer ABIN631414

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch AMOTL1 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für AMOTL1 Antikörper (N-Term) (ABIN631414)

Target: AMOTL1 (Angiomotin Like 1 (AMOTL1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AMOTL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AMOTL1 Antikörper

Bindungsspezifität: N-Term

Spezifität: AMOTL1 antibody was raised against the N terminal of AMOTL1

Aufreinigung: Affinity purified

Immunogen: AMOTL1 antibody was raised using the N terminal of AMOTL1 corresponding to a region with amino acids LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AMOTL1 Blocking Peptide, (ABIN5612049), is also available for use as a blocking control in assays to test for specificity of this AMOTL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMOTL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AMOTL1

Target: AMOTL1 (Angiomotin Like 1 (AMOTL1))

Andere Bezeichnung: AMOTL1

Hintergrund: AMOTL1 is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.

Molekulargewicht: 106 kDa (MW of target protein)