ARCN1 Antikörper (Middle Region)

Produktnummer ABIN631413

Produktdetails anti-ARCN1 Antikörper

Target: ARCN1 (Archain 1 (ARCN1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARCN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Archain 1 antibody was raised against the middle region of ARCN1

Aufreinigung: Affinity purified

Immunogen: Archain 1 antibody was raised using the middle region of ARCN1 corresponding to a region with amino acids GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Archain 1 Blocking Peptide, catalog no. 33R-3292, is also available for use as a blocking control in assays to test for specificity of this Archain 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARCN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARCN1

Target: ARCN1 (Archain 1 (ARCN1))

Andere Bezeichnung: Archain 1 (ARCN1 Produkte)

Synonyme: copd antikoerper, Tb08.5H5.420 antikoerper, COPD antikoerper, 4632432M07Rik antikoerper, nur17 antikoerper, arcn1 antikoerper, cb334 antikoerper, id:ibd3027 antikoerper, archain 1 antikoerper, coatomer delta subunit antikoerper, coatomer subunit delta antikoerper, Coatomer delta subunit antikoerper, archain 1 L homeolog antikoerper, archain 1a antikoerper, ARCN1 antikoerper, arcn1 antikoerper, Arcn1 antikoerper, Tc00.1047053503581.39 antikoerper, Tc00.1047053506573.91 antikoerper, Tc00.1047053511217.140 antikoerper, Tb927.8.5250 antikoerper, PVX_092350 antikoerper, LOC5577486 antikoerper, GL50803_6170 antikoerper, NAEGRDRAFT_79018 antikoerper, CC1G_00709 antikoerper, arcn1.L antikoerper, arcn1a antikoerper

Hintergrund: The gene that encodes ARCN1 maps in a region, which includes the mixed lineage leukemia and Friend leukemia virus integration 1 genes, where multiple disease-associated chromosome translocations occur. ARCN1 is an intracellular protein. Archain sequences are well conserved among eukaryotes and this protein may play a fundamental role in eukaryotic cell biology. It has similarities to heat shock proteins and clathrin-associated proteins, and may be involved in vesicle structure or trafficking.

Molekulargewicht: 57 kDa (MW of target protein)