EPB41 Antikörper (N-Term)

Produktnummer ABIN631411

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch EPB41 in WB. Er zeigt eine Reaktivität gegenüber Human und Hund.

Kurzübersicht für EPB41 Antikörper (N-Term) (ABIN631411)

Target: EPB41 (Erythrocyte Membrane Protein Band 4.1 (Elliptocytosis 1, RH-Linked) (EPB41))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPB41 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EPB41 Antikörper

Bindungsspezifität: N-Term

Spezifität: EPB41 antibody was raised against the N terminal of EPB41

Aufreinigung: Affinity purified

Immunogen: EPB41 antibody was raised using the N terminal of EPB41 corresponding to a region with amino acids SESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EPB41 Blocking Peptide, (ABIN5613382), is also available for use as a blocking control in assays to test for specificity of this EPB41 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPB41 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EPB41

Target: EPB41 (Erythrocyte Membrane Protein Band 4.1 (Elliptocytosis 1, RH-Linked) (EPB41))

Andere Bezeichnung: EPB41

Hintergrund: Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes and a variable degree of hemolytic anemia. Inherited as an autosomal dominant, elliptocytosis results from mutation in any one of several genes encoding proteins of the red cell membrane skeleton. The form discussed here is the one found in the 1950s to be linked to Rh blood group and more recently shown to be caused by a defect in protein 4.1. 'Rh-unlinked' forms of elliptocytosis are caused by mutation in the alpha-spectrin gene, the beta-spectrin gene, or the band 3 gene.

Molekulargewicht: 85 kDa (MW of target protein)