CHN2 Antikörper

Produktnummer ABIN631409

Produktdetails anti-CHN2 Antikörper

Target: CHN2 (Chimerin (Chimaerin) 2 (CHN2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CHN2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AFGVKVGVKGGFLWPPLKLFACSQISSLVRRAALTHNDNHFNYEKTHNFK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHN2 Blocking Peptide, catalog no. 33R-1162, is also available for use as a blocking control in assays to test for specificity of this CHN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHN2

Target: CHN2 (Chimerin (Chimaerin) 2 (CHN2))

Andere Bezeichnung: CHN2 (CHN2 Produkte)

Synonyme: 1700026N20Rik antikoerper, 4930557O16Rik antikoerper, ARHGAP3 antikoerper, Bch antikoerper, BCH antikoerper, CHN2-3 antikoerper, RHOGAP3 antikoerper, chimerin 2 antikoerper, chimerin 2 L homeolog antikoerper, chn2 antikoerper, CHN2 antikoerper, Chn2 antikoerper, chn2.L antikoerper

Hintergrund: CHN2 is a protein with a phorbol-ester/DAG-type zinc finger, a Rho-GAP domain and an SH2 domain. This protein has GTPase-activating protein activity that is regulated by phospholipid binding and binding of diacylglycerol (DAG) induces translocation of the protein from the cytosol to the Golgi apparatus membrane. CHN2 plays a role in the proliferation and migration of smooth muscle cells. Decreased expression of this gene is associated with high-grade gliomas and breast tumors, and increased expression of this gene is associated with lymphomas. Mutations in this gene have been associated with schizophrenia in men.

Molekulargewicht: 38 kDa (MW of target protein)