-
- Target Alle KLHL9 Antikörper anzeigen
- KLHL9 (Kelch-Like 9 (KLHL9))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KLHL9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- KLHL9 antibody was raised using a synthetic peptide corresponding to a region with amino acids SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY
- Top Product
- Discover our top product KLHL9 Primärantikörper
-
anti-Kelch-Like 9 (KLHL9) (AA 1-100) antibody
KLHL9 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Kelch-Like 9 (KLHL9) (AA 299-326) antibodyKLHL9 Reaktivität: Human, Maus WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB26346 unconjugated
anti-Kelch-Like 9 (KLHL9) antibodyKLHL9 Reaktivität: Maus IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Kelch-Like 9 (KLHL9) antibodyKLHL9 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Kelch-Like 9 (KLHL9) (AA 395-444) antibodyKLHL9 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Schwein, Kaninchen, Fledermaus, Hamster, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KLHL9 Blocking Peptide, catalog no. 33R-8307, is also available for use as a blocking control in assays to test for specificity of this KLHL9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLHL9 (Kelch-Like 9 (KLHL9))
- Andere Bezeichnung
- KLHL9 (KLHL9 Produkte)
- Synonyme
- 8030469P05 antikoerper, C530050O22Rik antikoerper, ENSMUSG00000070923 antikoerper, mKIAA1354 antikoerper, RGD1304814 antikoerper, kelch-like 9 antikoerper, kelch-like family member 9 antikoerper, kelch like family member 9 antikoerper, Klhl9 antikoerper, KLHL9 antikoerper
- Hintergrund
- KLHL9 is the substrate-specific adapter for a CUL3-based E3 ubiquitin-protein ligase complex. Within this complex, KLHL9 controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression.
- Molekulargewicht
- 69 kDa (MW of target protein)
-
Sie sind hier:
