KLHL9 Antikörper

Produktnummer ABIN631406

Der Kaninchen Polyklonal Anti-KLHL9-Antikörper wurde für WB validiert. Er ist geeignet, KLHL9 in Proben von Human zu detektieren.

Kurzübersicht für KLHL9 Antikörper (ABIN631406)

Target: KLHL9 (Kelch-Like 9 (KLHL9))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLHL9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KLHL9 Antikörper

Aufreinigung: Affinity purified

Immunogen: KLHL9 antibody was raised using a synthetic peptide corresponding to a region with amino acids SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLHL9 Blocking Peptide, (ABIN5614386), is also available for use as a blocking control in assays to test for specificity of this KLHL9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLHL9

Target: KLHL9 (Kelch-Like 9 (KLHL9))

Andere Bezeichnung: KLHL9

Hintergrund: KLHL9 is the substrate-specific adapter for a CUL3-based E3 ubiquitin-protein ligase complex. Within this complex, KLHL9 controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression.

Molekulargewicht: 69 kDa (MW of target protein)