GLYATL3 Antikörper (N-Term)

Produktnummer ABIN631402

Produktdetails anti-GLYATL3 Antikörper

Target: GLYATL3 (Glycine-N-Acyltransferase-Like 3 (GLYATL3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLYATL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C6 ORF140 antibody was raised against the N terminal Of C6 rf140

Aufreinigung: Affinity purified

Immunogen: C6 ORF140 antibody was raised using the N terminal Of C6 rf140 corresponding to a region with amino acids NPFQKEVVLDSWPDFKAVITRRQREAETDNLDHYTNAYAVFYKDVRAYRQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C6ORF140 Blocking Peptide, catalog no. 33R-6816, is also available for use as a blocking control in assays to test for specificity of this C6ORF140 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF140 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLYATL3

Target: GLYATL3 (Glycine-N-Acyltransferase-Like 3 (GLYATL3))

Andere Bezeichnung: C6ORF140 (GLYATL3 Produkte)

Synonyme: C6orf140 antikoerper, bA28H17.2 antikoerper, Gm5683 antikoerper, EG435528 antikoerper, glycine-N-acyltransferase like 3 antikoerper, glycine-N-acyltransferase-like 3 antikoerper, GLYATL3 antikoerper, Glyatl3 antikoerper

Hintergrund: C6orf140 encodes an acyltransferase which transfers the acyl group to the N-terminus of glycine.

Molekulargewicht: 33 kDa (MW of target protein)