TRMT61A Antikörper (N-Term)

Produktnummer ABIN631401

Produktdetails anti-TRMT61A Antikörper

Target: TRMT61A (tRNA Methyltransferase 61 Homolog A (TRMT61A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRMT61A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C14 ORF172 antibody was raised against the N terminal Of C14 rf172

Aufreinigung: Affinity purified

Immunogen: C14 ORF172 antibody was raised using the N terminal Of C14 rf172 corresponding to a region with amino acids MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C14ORF172 Blocking Peptide, catalog no. 33R-6422, is also available for use as a blocking control in assays to test for specificity of this C14ORF172 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF172 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRMT61A

Target: TRMT61A (tRNA Methyltransferase 61 Homolog A (TRMT61A))

Andere Bezeichnung: C14ORF172 (TRMT61A Produkte)

Synonyme: C14orf172 antikoerper, GCD14 antikoerper, Gcd14p antikoerper, TRM61 antikoerper, hTRM61 antikoerper, Gcd14 antikoerper, RGD1359191 antikoerper, Trm61 antikoerper, 6720458F09Rik antikoerper, AI606093 antikoerper, zgc:86657 antikoerper, tRNA methyltransferase 61A antikoerper, TRMT61A antikoerper, Trmt61a antikoerper, trmt61a antikoerper

Hintergrund: The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 31 kDa (MW of target protein)