TRIM42 Antikörper (C-Term)

Produktnummer ABIN631389

Produktdetails anti-TRIM42 Antikörper

Target: TRIM42 (Tripartite Motif Containing 42 (TRIM42))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIM42 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRIM42 antibody was raised against the C terminal of TRIM42

Aufreinigung: Affinity purified

Immunogen: TRIM42 antibody was raised using the C terminal of TRIM42 corresponding to a region with amino acids VKTPGPIVIYQTLVYPRAAKVYWTCPAEDVDSFEMEFYEVITSPPNNVQM

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIM42 Blocking Peptide, catalog no. 33R-9638, is also available for use as a blocking control in assays to test for specificity of this TRIM42 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM42 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIM42

Target: TRIM42 (Tripartite Motif Containing 42 (TRIM42))

Andere Bezeichnung: TRIM42 (TRIM42 Produkte)

Synonyme: TRIM42 antikoerper, PPP1R40 antikoerper, 4930486B16Rik antikoerper, tripartite motif containing 42 antikoerper, tripartite motif-containing 42 antikoerper, TRIM42 antikoerper, Trim42 antikoerper

Hintergrund: TRIM42 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.

Molekulargewicht: 80 kDa (MW of target protein)