TRIM42 Antikörper (C-Term)

Produktnummer ABIN631389

Dieses Anti-TRIM42-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TRIM42 in WB. Geeignet für Human, Hund, Maus und Ratte.

Kurzübersicht für TRIM42 Antikörper (C-Term) (ABIN631389)

Target: TRIM42 (Tripartite Motif Containing 42 (TRIM42))

Reaktivität: Human, Hund, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIM42 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TRIM42 Antikörper

Bindungsspezifität: C-Term

Spezifität: TRIM42 antibody was raised against the C terminal of TRIM42

Aufreinigung: Affinity purified

Immunogen: TRIM42 antibody was raised using the C terminal of TRIM42 corresponding to a region with amino acids VKTPGPIVIYQTLVYPRAAKVYWTCPAEDVDSFEMEFYEVITSPPNNVQM

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIM42 Blocking Peptide, (ABIN5616780), is also available for use as a blocking control in assays to test for specificity of this TRIM42 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM42 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIM42

Target: TRIM42 (Tripartite Motif Containing 42 (TRIM42))

Andere Bezeichnung: TRIM42

Hintergrund: TRIM42 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.

Molekulargewicht: 80 kDa (MW of target protein)