RSPRY1 Antikörper (N-Term)

Produktnummer ABIN631386

Produktdetails anti-RSPRY1 Antikörper

Target: RSPRY1 (Ring Finger and SPRY Domain Containing 1 (RSPRY1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RSPRY1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RSPRY1 antibody was raised against the N terminal of RSPRY1

Aufreinigung: Affinity purified

Immunogen: RSPRY1 antibody was raised using the N terminal of RSPRY1 corresponding to a region with amino acids RSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RSPRY1 Blocking Peptide, catalog no. 33R-8205, is also available for use as a blocking control in assays to test for specificity of this RSPRY1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSPRY1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RSPRY1

Target: RSPRY1 (Ring Finger and SPRY Domain Containing 1 (RSPRY1))

Andere Bezeichnung: RSPRY1 (RSPRY1 Produkte)

Synonyme: si:ch211-257c9.1 antikoerper, 4930470D19Rik antikoerper, AI608258 antikoerper, RGD1308847 antikoerper, ring finger and SPRY domain containing 1 antikoerper, ring finger and SPRY domain containing 1 S homeolog antikoerper, RSPRY1 antikoerper, rspry1 antikoerper, rspry1.S antikoerper, Rspry1 antikoerper

Hintergrund: RSPRY1 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of RSPRY1 remains unknown.

Molekulargewicht: 64 kDa (MW of target protein)