FBXW11 Antikörper (N-Term)

Produktnummer ABIN631385

Produktdetails anti-FBXW11 Antikörper

Target: FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXW11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXW11 antibody was raised against the N terminal of FBXW11

Aufreinigung: Affinity purified

Immunogen: FBXW11 antibody was raised using the N terminal of FBXW11 corresponding to a region with amino acids EPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXW11 Blocking Peptide, catalog no. 33R-2627, is also available for use as a blocking control in assays to test for specificity of this FBXW11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXW11

Target: FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))

Andere Bezeichnung: FBXW11 (FBXW11 Produkte)

Synonyme: BTRC2 antikoerper, BTRCP2 antikoerper, FBW1B antikoerper, FBXW1B antikoerper, Fbw11 antikoerper, Hos antikoerper, 2310065A07Rik antikoerper, AA536858 antikoerper, Fbxw1b antikoerper, HOS antikoerper, btrc2 antikoerper, fbxw11a antikoerper, wu:fa12e12 antikoerper, wu:fb11f03 antikoerper, zgc:63728 antikoerper, fbxw11 antikoerper, fbxw11b antikoerper, fbxw1b antikoerper, wu:fd14d12 antikoerper, wu:fi43f07 antikoerper, F-box and WD repeat domain containing 11 antikoerper, F-box and WD-40 domain protein 11 antikoerper, F-box/WD repeat-containing protein 11 antikoerper, F-box and WD repeat domain containing 11b antikoerper, F-box and WD repeat domain containing 11a antikoerper, FBXW11 antikoerper, Fbxw11 antikoerper, LOC100199403 antikoerper, fbxw11b antikoerper, fbxw11a antikoerper

Hintergrund: FBXW11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.

Molekulargewicht: 61 kDa (MW of target protein)