LONRF3 Antikörper (N-Term)

Produktnummer ABIN631381

Produktdetails anti-LONRF3 Antikörper

Target: LONRF3 (LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LONRF3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LONRF3 antibody was raised against the N terminal of LONRF3

Aufreinigung: Affinity purified

Immunogen: LONRF3 antibody was raised using the N terminal of LONRF3 corresponding to a region with amino acids QPPPPLRVNVVLSGLLGKLFPGPARASQLRHEGNRLYRERQVEAALLKYN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LONRF3 Blocking Peptide, catalog no. 33R-7681, is also available for use as a blocking control in assays to test for specificity of this LONRF3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LONRF3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LONRF3

Target: LONRF3 (LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3))

Andere Bezeichnung: LONRF3 (LONRF3 Produkte)

Synonyme: RNF127 antikoerper, 4932412G04Rik antikoerper, 5730439E01Rik antikoerper, A830039N02Rik antikoerper, AU023707 antikoerper, Rnf127 antikoerper, RGD1565451 antikoerper, LON peptidase N-terminal domain and ring finger 3 antikoerper, LONRF3 antikoerper, Lonrf3 antikoerper

Hintergrund: LONRF3 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear.

Molekulargewicht: 84 kDa (MW of target protein)