TRIM49 Antikörper (N-Term)

Produktnummer ABIN631376

Der Kaninchen Polyklonal Anti-TRIM49-Antikörper wurde für WB validiert. Er ist geeignet, TRIM49 in Proben von Human zu detektieren.

Kurzübersicht für TRIM49 Antikörper (N-Term) (ABIN631376)

Target: TRIM49 (Tripartite Motif Containing 49 (TRIM49))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIM49 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TRIM49 Antikörper

Bindungsspezifität: N-Term

Spezifität: TRIM49 antibody was raised against the N terminal of TRIM49

Aufreinigung: Affinity purified

Immunogen: TRIM49 antibody was raised using the N terminal of TRIM49 corresponding to a region with amino acids RPCFYLNWQDIPFLVQCSECTKSTEQINLKTNIHLKKMASLARKVSLWLF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIM49 Blocking Peptide, (ABIN5616783), is also available for use as a blocking control in assays to test for specificity of this TRIM49 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM49 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIM49

Target: TRIM49 (Tripartite Motif Containing 49 (TRIM49))

Andere Bezeichnung: TRIM49

Hintergrund: TRIM49 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein has been found to be preferentially expressed in testis.

Molekulargewicht: 53 kDa (MW of target protein)