FBXO21 Antikörper (N-Term)

Produktnummer ABIN631372

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch FBXO21 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für FBXO21 Antikörper (N-Term) (ABIN631372)

Target: FBXO21 (F-Box Protein 21 (FBXO21))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXO21 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FBXO21 Antikörper

Bindungsspezifität: N-Term

Spezifität: FBXO21 antibody was raised against the N terminal of FBXO21

Aufreinigung: Affinity purified

Immunogen: FBXO21 antibody was raised using the N terminal of FBXO21 corresponding to a region with amino acids KEQFRVRWPSLMKHYSPTDYVNWLEEYKVRQKAGLEARKIVASFSKRFFS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXO21 Blocking Peptide, (ABIN939736), is also available for use as a blocking control in assays to test for specificity of this FBXO21 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO21 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXO21

Target: FBXO21 (F-Box Protein 21 (FBXO21))

Andere Bezeichnung: FBXO21

Hintergrund: FBXO21 contains 1 F-box domain. It is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.

Molekulargewicht: 71 kDa (MW of target protein)