F-Box Protein 3 Antikörper (N-Term)

Produktnummer ABIN631362

Dieses Anti-F-Box Protein 3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von F-Box Protein 3 in WB. Geeignet für Human.

Kurzübersicht für F-Box Protein 3 Antikörper (N-Term) (ABIN631362)

Target: F-Box Protein 3 (FBXO3)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser F-Box Protein 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-F-Box Protein 3 Antikörper

Bindungsspezifität: N-Term

Spezifität: FBXO3 antibody was raised against the N terminal of FBXO3

Aufreinigung: Affinity purified

Immunogen: FBXO3 antibody was raised using the N terminal of FBXO3 corresponding to a region with amino acids NCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXO3 Blocking Peptide, (ABIN5613540), is also available for use as a blocking control in assays to test for specificity of this FBXO3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu F-Box Protein 3

Target: F-Box Protein 3 (FBXO3)

Andere Bezeichnung: FBXO3

Hintergrund: FBXO3 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO3 belongs to the Fbxs class.

Molekulargewicht: 47 kDa (MW of target protein)