FBXW2 Antikörper (Middle Region)

Produktnummer ABIN631359

Produktdetails anti-FBXW2 Antikörper

Target: FBXW2 (F-Box and WD Repeat Domain Containing 2 (FBXW2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXW2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXW2 antibody was raised against the middle region of FBXW2

Aufreinigung: Affinity purified

Immunogen: FBXW2 antibody was raised using the middle region of FBXW2 corresponding to a region with amino acids SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXW2 Blocking Peptide, catalog no. 33R-8600, is also available for use as a blocking control in assays to test for specificity of this FBXW2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXW2

Target: FBXW2 (F-Box and WD Repeat Domain Containing 2 (FBXW2))

Andere Bezeichnung: FBXW2 (FBXW2 Produkte)

Synonyme: FBXW2 antikoerper, md6 antikoerper, fbw2 antikoerper, fwd2 antikoerper, MGC53244 antikoerper, FBW2 antikoerper, Fwd2 antikoerper, Md6 antikoerper, wu:fc72f10 antikoerper, zgc:110365 antikoerper, 2700071L08Rik antikoerper, MD6 antikoerper, F-box and WD repeat domain containing 2 antikoerper, F-box and WD repeat domain containing 2 L homeolog antikoerper, F-box and WD-40 domain protein 2 antikoerper, FBXW2 antikoerper, fbxw2 antikoerper, Fbxw2 antikoerper, fbxw2.L antikoerper

Hintergrund: F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins.

Molekulargewicht: 51 kDa (MW of target protein)