FBXW2 Antikörper (Middle Region)

Produktnummer ABIN631359

Der Kaninchen Polyklonal anti-FBXW2 Antikörper (ABIN631359) detektiert spezifisch FBXW2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für FBXW2 Antikörper (Middle Region) (ABIN631359)

Target: FBXW2 (F-Box and WD Repeat Domain Containing 2 (FBXW2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXW2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FBXW2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: FBXW2 antibody was raised against the middle region of FBXW2

Aufreinigung: Affinity purified

Immunogen: FBXW2 antibody was raised using the middle region of FBXW2 corresponding to a region with amino acids SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXW2 Blocking Peptide, (ABIN5613555), is also available for use as a blocking control in assays to test for specificity of this FBXW2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXW2

Target: FBXW2 (F-Box and WD Repeat Domain Containing 2 (FBXW2))

Andere Bezeichnung: FBXW2

Hintergrund: F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins.

Molekulargewicht: 51 kDa (MW of target protein)