UBE4A Antikörper

Produktnummer ABIN631353

Der Kaninchen Polyklonal anti-UBE4A Antikörper (ABIN631353) detektiert spezifisch UBE4A in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für UBE4A Antikörper (ABIN631353)

Target: UBE4A (Ubiquitination Factor E4A (UBE4A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE4A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UBE4A Antikörper

Aufreinigung: Affinity purified

Immunogen: UBE4 A antibody was raised using a synthetic peptide corresponding to a region with amino acids QYAPQLAEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE4A Blocking Peptide, (ABIN5616880), is also available for use as a blocking control in assays to test for specificity of this UBE4A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE4A

Target: UBE4A (Ubiquitination Factor E4A (UBE4A))

Andere Bezeichnung: UBE4A

Hintergrund: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4A is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly.

Molekulargewicht: 123 kDa (MW of target protein)