UBE4A Antikörper
-
- Target Alle UBE4A Antikörper anzeigen
- UBE4A (Ubiquitination Factor E4A (UBE4A))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UBE4A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- UBE4 A antibody was raised using a synthetic peptide corresponding to a region with amino acids QYAPQLAEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYR
- Top Product
- Discover our top product UBE4A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UBE4A Blocking Peptide, catalog no. 33R-7789, is also available for use as a blocking control in assays to test for specificity of this UBE4A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE4A (Ubiquitination Factor E4A (UBE4A))
- Andere Bezeichnung
- UBE4A (UBE4A Produkte)
- Synonyme
- 4732444G18Rik antikoerper, 9930123J21Rik antikoerper, UFD2b antikoerper, ufd2 antikoerper, ubox2 antikoerper, E4 antikoerper, UBOX2 antikoerper, UFD2 antikoerper, Ab2-232 antikoerper, ubiquitination factor E4A S homeolog antikoerper, ubiquitination factor E4A antikoerper, ubiquitination factor E4A (UFD2 homolog, yeast) antikoerper, ubiquitin conjugation factor E4 A antikoerper, putative ubiquitination factor E4a antikoerper, ube4a.S antikoerper, Ube4a antikoerper, UBE4A antikoerper, ube4a antikoerper, LOC5563714 antikoerper, Smp_030780 antikoerper
- Hintergrund
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4A is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly.
- Molekulargewicht
- 123 kDa (MW of target protein)
-