UBE2L6 Antikörper (N-Term)

Produktnummer ABIN631351

Produktdetails anti-UBE2L6 Antikörper

Target: UBE2L6 (Ubiquitin-Conjugating Enzyme E2L 6 (UBE2L6))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2L6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UBE2 L6 antibody was raised against the N terminal of UBE2 6

Aufreinigung: Affinity purified

Immunogen: UBE2 L6 antibody was raised using the N terminal of UBE2 6 corresponding to a region with amino acids LLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2L6 Blocking Peptide, catalog no. 33R-5160, is also available for use as a blocking control in assays to test for specificity of this UBE2L6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2L6

Target: UBE2L6 (Ubiquitin-Conjugating Enzyme E2L 6 (UBE2L6))

Andere Bezeichnung: UBE2L6 (UBE2L6 Produkte)

Synonyme: UBE2L6 antikoerper, RIG-B antikoerper, UBCH8 antikoerper, 2810489I21Rik antikoerper, Ubce8 antikoerper, Ubcm8 antikoerper, UbcM8 antikoerper, ubiquitin conjugating enzyme E2 L6 antikoerper, ubiquitin-conjugating enzyme E2L 6 antikoerper, UBE2L6 antikoerper, Ube2l6 antikoerper

Hintergrund: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L6 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by UBE2L3 gene.

Molekulargewicht: 18 kDa (MW of target protein)