TRIM67 Antikörper (C-Term)
Kurzübersicht für TRIM67 Antikörper (C-Term) (ABIN631345)
Target
Reaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- C-Term
-
Spezifität
- TRIM67 antibody was raised against the C terminal of TRIM67
-
Aufreinigung
- Affinity purified
-
Immunogen
- TRIM67 antibody was raised using the C terminal of TRIM67 corresponding to a region with amino acids GGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRN
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
TRIM67 Blocking Peptide, (ABIN938691), is also available for use as a blocking control in assays to test for specificity of this TRIM67 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM67 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- TRIM67 (Tripartite Motif Containing 67 (TRIM67))
-
Andere Bezeichnung
- TRIM67
-
Hintergrund
- The specific function of TRIM67 is not yet known.
-
Molekulargewicht
- 84 kDa (MW of target protein)
Target
-