RNF160 Antikörper (N-Term)

Produktnummer ABIN631341

Dieses Anti-RNF160-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RNF160 in WB. Geeignet für Human.

Kurzübersicht für RNF160 Antikörper (N-Term) (ABIN631341)

Target: RNF160 (ZNF294) (Zinc Finger Protein 294 (ZNF294))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF160 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RNF160 Antikörper

Bindungsspezifität: N-Term

Spezifität: ZNF294 antibody was raised against the N terminal of ZNF294

Aufreinigung: Affinity purified

Immunogen: ZNF294 antibody was raised using the N terminal of ZNF294 corresponding to a region with amino acids MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZNF294 Blocking Peptide, (ABIN5617160), is also available for use as a blocking control in assays to test for specificity of this ZNF294 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF294 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF160

Target: RNF160 (ZNF294) (Zinc Finger Protein 294 (ZNF294))

Andere Bezeichnung: ZNF294

Hintergrund: ZNF294 may function as an E3 ubiquitin-protein ligase. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Molekulargewicht: 200 kDa (MW of target protein)