PCGF6 Antikörper (Middle Region)
-
- Target Alle PCGF6 Antikörper anzeigen
- PCGF6 (Polycomb Group Ring Finger 6 (PCGF6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PCGF6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PCGF6 antibody was raised against the middle region of PCGF6
- Aufreinigung
- Affinity purified
- Immunogen
- PCGF6 antibody was raised using the middle region of PCGF6 corresponding to a region with amino acids TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ
- Top Product
- Discover our top product PCGF6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PCGF6 Blocking Peptide, catalog no. 33R-9248, is also available for use as a blocking control in assays to test for specificity of this PCGF6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCGF6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCGF6 (Polycomb Group Ring Finger 6 (PCGF6))
- Andere Bezeichnung
- PCGF6 (PCGF6 Produkte)
- Synonyme
- im:7144322 antikoerper, si:ch211-67n3.7 antikoerper, MBLR antikoerper, RNF134 antikoerper, 4933407A11Rik antikoerper, AI604840 antikoerper, Rnf134 antikoerper, polycomb group ring finger 6 antikoerper, PCGF6 antikoerper, pcgf6 antikoerper, Pcgf6 antikoerper
- Hintergrund
- The protein encoded by this gene contains a RING finger motif, which is most closely related to those of polycomb group (PcG) proteins RNF110/MEL-18 and BMI1. PcG proteins are known to form protein complexes and function as transcription repressors. This protein has been shown to interact with some PcG proteins and act as a transcription repressor. The activity of this protein is found to be regulated by cell cycle dependent phosphorylation. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Molekulargewicht
- 30 kDa (MW of target protein)
-