PCGF6 Antikörper (Middle Region)

Produktnummer ABIN631335

Der Kaninchen Polyklonal anti-PCGF6 Antikörper (ABIN631335) detektiert spezifisch PCGF6 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für PCGF6 Antikörper (Middle Region) (ABIN631335)

Target: PCGF6 (Polycomb Group Ring Finger 6 (PCGF6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCGF6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PCGF6 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PCGF6 antibody was raised against the middle region of PCGF6

Aufreinigung: Affinity purified

Immunogen: PCGF6 antibody was raised using the middle region of PCGF6 corresponding to a region with amino acids TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCGF6 Blocking Peptide, (ABIN5615256), is also available for use as a blocking control in assays to test for specificity of this PCGF6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCGF6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCGF6

Target: PCGF6 (Polycomb Group Ring Finger 6 (PCGF6))

Andere Bezeichnung: PCGF6

Hintergrund: The protein encoded by this gene contains a RING finger motif, which is most closely related to those of polycomb group (PcG) proteins RNF110/MEL-18 and BMI1. PcG proteins are known to form protein complexes and function as transcription repressors. This protein has been shown to interact with some PcG proteins and act as a transcription repressor. The activity of this protein is found to be regulated by cell cycle dependent phosphorylation. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molekulargewicht: 30 kDa (MW of target protein)