METTL2B Antikörper (N-Term)

Produktnummer ABIN631333

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch METTL2B in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für METTL2B Antikörper (N-Term) (ABIN631333)

Target: METTL2B (Methyltransferase Like 2B (METTL2B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser METTL2B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-METTL2B Antikörper

Bindungsspezifität: N-Term

Spezifität: METTL2 B antibody was raised against the N terminal of METTL2

Aufreinigung: Affinity purified

Immunogen: METTL2 B antibody was raised using the N terminal of METTL2 corresponding to a region with amino acids AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

METTL2B Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this METTL2B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu METTL2B

Target: METTL2B (Methyltransferase Like 2B (METTL2B))

Andere Bezeichnung: METTL2B

Hintergrund: METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized.

Molekulargewicht: 43 kDa (MW of target protein)