TRIM55 Antikörper (N-Term)

Produktnummer ABIN631327

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TRIM55 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für TRIM55 Antikörper (N-Term) (ABIN631327)

Target: TRIM55 (Tripartite Motif Containing 55 (TRIM55))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIM55 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TRIM55 Antikörper

Bindungsspezifität: N-Term

Spezifität: TRIM55 antibody was raised against the N terminal of TRIM55

Aufreinigung: Affinity purified

Immunogen: TRIM55 antibody was raised using the N terminal of TRIM55 corresponding to a region with amino acids SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIM55 Blocking Peptide, (ABIN5616787), is also available for use as a blocking control in assays to test for specificity of this TRIM55 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM55 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIM55

Target: TRIM55 (Tripartite Motif Containing 55 (TRIM55))

Andere Bezeichnung: TRIM55

Hintergrund: TRIM55 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres.

Molekulargewicht: 60 kDa (MW of target protein)