PDZRN4 Antikörper (N-Term)

Produktnummer ABIN631326

Produktdetails anti-PDZRN4 Antikörper

Target: PDZRN4 (PDZ Domain Containing Ring Finger 4 (PDZRN4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDZRN4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PDZRN4 antibody was raised against the N terminal of PDZRN4

Aufreinigung: Affinity purified

Immunogen: PDZRN4 antibody was raised using the N terminal of PDZRN4 corresponding to a region with amino acids SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDZRN4 Blocking Peptide, catalog no. 33R-8371, is also available for use as a blocking control in assays to test for specificity of this PDZRN4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDZRN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDZRN4

Target: PDZRN4 (PDZ Domain Containing Ring Finger 4 (PDZRN4))

Andere Bezeichnung: PDZRN4 (PDZRN4 Produkte)

Synonyme: LNX4 antikoerper, SAMCAP3L antikoerper, PDZ domain containing ring finger 4 antikoerper, PDZRN4 antikoerper

Hintergrund: The function of PDZRN4 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 89 kDa (MW of target protein)