GNLY Antikörper (N-Term)
-
- Target Alle GNLY Antikörper anzeigen
- GNLY (Granulysin (GNLY))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GNLY Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Granulysin antibody was raised against the n terminal of GNLY
- Aufreinigung
- Affinity purified
- Immunogen
- Granulysin antibody was raised using the N terminal of GNLY corresponding to a region with amino acids MASGPLGPGARPTRLHPPFPPPAHIKPGAPPGENPELSGLERILARHQLP
- Top Product
- Discover our top product GNLY Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Granulysin Blocking Peptide, catalog no. 33R-5745, is also available for use as a blocking control in assays to test for specificity of this Granulysin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNLY antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNLY (Granulysin (GNLY))
- Andere Bezeichnung
- Granulysin (GNLY Produkte)
- Hintergrund
- GNLY is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. GNLY is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms.
- Molekulargewicht
- 24 kDa (MW of target protein)
-