GNLY Antikörper (N-Term)

Produktnummer ABIN631324

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch GNLY in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für GNLY Antikörper (N-Term) (ABIN631324)

Target: GNLY (Granulysin (GNLY))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNLY Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GNLY Antikörper

Bindungsspezifität: N-Term

Spezifität: Granulysin antibody was raised against the n terminal of GNLY

Aufreinigung: Affinity purified

Immunogen: Granulysin antibody was raised using the N terminal of GNLY corresponding to a region with amino acids MASGPLGPGARPTRLHPPFPPPAHIKPGAPPGENPELSGLERILARHQLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Granulysin Blocking Peptide, (ABIN5613852), is also available for use as a blocking control in assays to test for specificity of this Granulysin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNLY antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNLY

Target: GNLY (Granulysin (GNLY))

Andere Bezeichnung: Granulysin

Hintergrund: GNLY is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. GNLY is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms.

Molekulargewicht: 24 kDa (MW of target protein)