RNF165 Antikörper (Middle Region)

Produktnummer ABIN631316

Der Kaninchen Polyklonal Anti-RNF165-Antikörper wurde für WB und IHC validiert. Er ist geeignet, RNF165 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für RNF165 Antikörper (Middle Region) (ABIN631316)

Target: RNF165 (Ring Finger Protein 165 (RNF165))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF165 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RNF165 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RNF165 antibody was raised against the middle region of RNF165

Aufreinigung: Affinity purified

Immunogen: RNF165 antibody was raised using the middle region of RNF165 corresponding to a region with amino acids SSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF165 Blocking Peptide, (ABIN5615892), is also available for use as a blocking control in assays to test for specificity of this RNF165 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF165 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF165

Target: RNF165 (Ring Finger Protein 165 (RNF165))

Andere Bezeichnung: RNF165

Hintergrund: RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.

Molekulargewicht: 38 kDa (MW of target protein)