OCIAD1 Antikörper (C-Term)

Produktnummer ABIN631311

Der Kaninchen Polyklonal anti-OCIAD1 Antikörper (ABIN631311) detektiert spezifisch OCIAD1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für OCIAD1 Antikörper (C-Term) (ABIN631311)

Target: OCIAD1 (OCIA Domain Containing 1 (OCIAD1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OCIAD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OCIAD1 Antikörper

Bindungsspezifität: C-Term

Spezifität: OCIAD1 antibody was raised against the C terminal of OCIAD1

Aufreinigung: Affinity purified

Immunogen: OCIAD1 antibody was raised using the C terminal of OCIAD1 corresponding to a region with amino acids QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OCIAD1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this OCIAD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCIAD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OCIAD1

Target: OCIAD1 (OCIA Domain Containing 1 (OCIAD1))

Andere Bezeichnung: OCIAD1

Hintergrund: OCIAD1 belongs to the OCIAD1 family. It contains 1 OCIA domain. OCIAD1 is over-expressed in metastatic ovarian cancer.

Molekulargewicht: 27 kDa (MW of target protein)