EFHD2 Antikörper (N-Term)

Produktnummer ABIN631302

Dieses Anti-EFHD2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von EFHD2 in WB. Geeignet für Human.

Kurzübersicht für EFHD2 Antikörper (N-Term) (ABIN631302)

Target: EFHD2 (EF-Hand Domain Family, Member D2 (EFHD2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EFHD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EFHD2 Antikörper

Bindungsspezifität: N-Term

Spezifität: EFHD2 antibody was raised against the N terminal of EFHD2

Aufreinigung: Affinity purified

Immunogen: EFHD2 antibody was raised using the N terminal of EFHD2 corresponding to a region with amino acids MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EFHD2 Blocking Peptide, (ABIN5613315), is also available for use as a blocking control in assays to test for specificity of this EFHD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFHD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EFHD2

Target: EFHD2 (EF-Hand Domain Family, Member D2 (EFHD2))

Andere Bezeichnung: EFHD2

Hintergrund: EFHD2 may regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. It plays a role as negative regulator of the canonical NF-kappa-B-activating branch. EFHD2 controls spontaneous apoptosis through the regulation of BCL2L1 abundance.

Molekulargewicht: 26 kDa (MW of target protein)