LCMT2 Antikörper (C-Term)
-
- Target Alle LCMT2 Antikörper anzeigen
- LCMT2 (Leucine Carboxyl Methyltransferase 2 (LCMT2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LCMT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LCMT2 antibody was raised against the C terminal of LCMT2
- Aufreinigung
- Affinity purified
- Immunogen
- LCMT2 antibody was raised using the C terminal of LCMT2 corresponding to a region with amino acids PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LCMT2 Blocking Peptide, catalog no. 33R-7414, is also available for use as a blocking control in assays to test for specificity of this LCMT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCMT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LCMT2 (Leucine Carboxyl Methyltransferase 2 (LCMT2))
- Andere Bezeichnung
- LCMT2 (LCMT2 Produkte)
- Hintergrund
- LCMT2 belongs to the highly variable methyltransferase superfamily. This gene is the inferred homolog of the Saccharomyces cerevisiae carboxymethyltransferase gene PPM2 that is essential for the synthesis of the hypermodified guanosine Wybutosine (yW).
- Molekulargewicht
- 75 kDa (MW of target protein)
-