UBE2K Antikörper

Produktnummer ABIN631297

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch UBE2K in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für UBE2K Antikörper (ABIN631297)

Target: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2K Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UBE2K Antikörper

Aufreinigung: Affinity purified

Immunogen: UBE2 K antibody was raised using a synthetic peptide corresponding to a region with amino acids QTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2K Blocking Peptide, (ABIN5616870), is also available for use as a blocking control in assays to test for specificity of this UBE2K antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2K

Target: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Andere Bezeichnung: UBE2K

Hintergrund: UBE2K belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington's disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation.

Molekulargewicht: 22 kDa (MW of target protein)