RAD18 Antikörper

Produktnummer ABIN631295

Der Kaninchen Polyklonal Anti-RAD18 Antikörper wurde für WB validiert. Er ist geeignet, RAD18 in Proben von Human zu detektieren.

Kurzübersicht für RAD18 Antikörper (ABIN631295)

Target: RAD18 (E3 ubiquitin-protein ligase RAD18 (RAD18))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAD18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAD18 Antikörper

Aufreinigung: Affinity purified

Immunogen: RAD18 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAD18 Blocking Peptide, (ABIN5615730), is also available for use as a blocking control in assays to test for specificity of this RAD18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAD18

Target: RAD18 (E3 ubiquitin-protein ligase RAD18 (RAD18))

Andere Bezeichnung: RAD18

Hintergrund: RAD18 is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA.

Molekulargewicht: 56 kDa (MW of target protein)