AHCY Antikörper (N-Term)

Produktnummer ABIN631294

Produktdetails anti-AHCY Antikörper

Target: AHCY (Adenosylhomocysteinase (AHCY))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AHCY Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AHCY antibody was raised against the N terminal of AHCY

Aufreinigung: Affinity purified

Immunogen: AHCY antibody was raised using the N terminal of AHCY corresponding to a region with amino acids SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AHCY Blocking Peptide, catalog no. 33R-8359, is also available for use as a blocking control in assays to test for specificity of this AHCY antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHCY antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AHCY

Target: AHCY (Adenosylhomocysteinase (AHCY))

Andere Bezeichnung: AHCY (AHCY Produkte)

Synonyme: sahh antikoerper, PSPTO5068 antikoerper, Ahcy antikoerper, SAHH antikoerper, adoHcyase antikoerper, ahcy antikoerper, AA987153 antikoerper, AL024110 antikoerper, CuBP antikoerper, D150 antikoerper, cb1079 antikoerper, hm:zeh1173 antikoerper, hm:zeh1364 antikoerper, wu:fj67b02 antikoerper, adenosylhomocysteinase antikoerper, Adenosylhomocysteinase antikoerper, S-adenosylhomocysteine hydrolase antikoerper, adenosylhomocysteinase S homeolog antikoerper, AHCY antikoerper, ahcy antikoerper, ahcY antikoerper, MMAH_RS02605 antikoerper, Srot_2217 antikoerper, Ndas_3755 antikoerper, Deba_0936 antikoerper, Palpr_2392 antikoerper, Calni_0569 antikoerper, LOC100282150 antikoerper, Intca_2510 antikoerper, Marky_0392 antikoerper, Desac_1394 antikoerper, Tc00.1047053511229.50 antikoerper, Tc00.1047053511589.200 antikoerper, Tb11.01.1350 antikoerper, LMJF_36_3910 antikoerper, MCYG_06244 antikoerper, Ahcy antikoerper, ahcy.S antikoerper

Hintergrund: S-adenosylhomocysteine hydrolase catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia.

Molekulargewicht: 48 kDa (MW of target protein)