TYMS Antikörper (C-Term)

Produktnummer ABIN631290

Produktdetails anti-TYMS Antikörper

Target: TYMS (Thymidylate Synthetase (TYMS))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TYMS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TYMS antibody was raised against the C terminal of TYMS

Aufreinigung: Affinity purified

Immunogen: TYMS antibody was raised using the C terminal of TYMS corresponding to a region with amino acids HIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKME

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TYMS Blocking Peptide, catalog no. 33R-3753, is also available for use as a blocking control in assays to test for specificity of this TYMS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYMS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TYMS

Target: TYMS (Thymidylate Synthetase (TYMS))

Andere Bezeichnung: TYMS (TYMS Produkte)

Synonyme: FN1 antikoerper, ECK2823 antikoerper, JW2795 antikoerper, ts antikoerper, Ts antikoerper, HST422 antikoerper, TMS antikoerper, TS antikoerper, thymidylate synthetase antikoerper, contains intron in T4 phage antikoerper, ThyE antikoerper, thymidylate synthase antikoerper, thymidylate synthetase L homeolog antikoerper, TYMS antikoerper, thyA antikoerper, td antikoerper, thyE antikoerper, DDA3937_RS04960 antikoerper, tyms.L antikoerper, XBJ1_RS15770 antikoerper, EAMY_RS20680 antikoerper, Tyms antikoerper

Substanzklasse: Viral Protein

Hintergrund: TYMS catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases