TYMS Antikörper (C-Term)

Produktnummer ABIN631290

Dieses Anti-TYMS-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TYMS in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für TYMS Antikörper (C-Term) (ABIN631290)

Target: TYMS (Thymidylate Synthetase (TYMS))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TYMS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TYMS Antikörper

Bindungsspezifität: C-Term

Spezifität: TYMS antibody was raised against the C terminal of TYMS

Aufreinigung: Affinity purified

Immunogen: TYMS antibody was raised using the C terminal of TYMS corresponding to a region with amino acids HIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKME

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TYMS Blocking Peptide, (ABIN939139), is also available for use as a blocking control in assays to test for specificity of this TYMS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYMS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TYMS

Target: TYMS (Thymidylate Synthetase (TYMS))

Andere Bezeichnung: TYMS

Hintergrund: TYMS catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases